PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000428G0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family MYB_related
Protein Properties Length: 1308aa    MW: 141478 Da    PI: 6.4104
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000428G0040genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.1e-09439481347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E e + +  +++G++ +++I++ ++ ++t  +c+++++k+
  PH01000428G0040 439 PWTQDEKEVFMEMLARFGKD-FSKISSFLQ-HKTTADCVEFYYKH 481
                      8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.62E-14423484IPR009057Homeodomain-like
PROSITE profilePS5129315.641435486IPR017884SANT domain
SMARTSM007177.7E-9436484IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-7438483IPR009057Homeodomain-like
PfamPF002492.9E-7438481IPR001005SANT/Myb domain
PROSITE profilePS5129312.6646697IPR017884SANT domain
SMARTSM007174.5E-6647695IPR001005SANT/Myb domain
SuperFamilySSF466897.72E-9650697IPR009057Homeodomain-like
CDDcd001671.42E-4651689No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1308 aa     Download sequence    Send to blast
MESNKDAPGA EIQACNDEVP IKLDQLGGDP IGSLANVLAE LLQHEDSCSG DSKRLTSTSK  60
LLLLNESITK ELEKTELEID SLEGELKSVN TEAGNRALKG SPTVVTCAQS PSPSYGTSKV  120
PASTCETTSP VKEQGEFTPS PKITVEQDAD VNGAELMEAK TAPVHNVKTV SSEESVACPG  180
VADAQISAAA DVVPLKLSEG IGAQIKVDSE RQEANSCHDN VNSMKADGSD DLSMRPCSYH  240
DDNYNLIPSI IATNNDIAKE ASELVFKPLS ADRTHLDLLA LSHLSSQRKN DLIIKEKLAI  300
RKNRLRFKEQ ILTFKFKVLR HLWKEDVRLL SMRKQRSKSN KRIDQVNRAS HSGSQRQRSS  360
NRSRLAMPAG NLSTFPITEI SDVANKLFSE FQVKRCRNYL KMPALIIDQK EKADARFISK  420
NALIEDPVSV EKEQAMINPW TQDEKEVFME MLARFGKDFS KISSFLQHKT TADCVEFYYK  480
HHKSDSFREV KKLLDLRQQQ KPTSNYLGTN SGKKWNPEAN AASLDMLGVA SVVAAHGLDY  540
ANRVEKISSK SILRTAYGSD IPFVTKGSTN KDSVGNVPLH ERESVAADVL AGICGTLSPE  600
GLGSCITSSA DPGQKISITR MEHLVTPEVD KSFGEEGTLS DQECEVDPVD WNDDEKSIFI  660
EAMNNYGKDF ARISSCVKSK SYEQCKVFFS KARKSLGLDL IHQGDVDVGL PTSDTNGGRS  720
DTDEACAAEM DSTICSTQSC SKMEMDVCPA VDGAIQGRPL SGITSKQPEA DDSNGPGVVD  780
VKVEEGEIKA DKNCNILVDH KRLSEATHQA SCVLIDINRP ESRENPQTTE GVNQVNIHGK  840
GAMASSTEQA AAAHLEIRSS LHSVEAIQSS KASEGICTEV SRTEGSSHHA PEGALMKSGN  900
STPSVCLPAE GGSKENVFHI SNMAGVSSIR PAFTSSYQNT MPADLLPSKP KPQVTPLTPK  960
DLMPVQFSSV LPDPTSIRFE GIASITTPNF EDHGKKVGNA SGAKDTNKFP TYKDQSSNQL  1020
DGLFRNIDGY MQQRRNHHLA TEVPVLSESI ASGTVGISQS DLFTLAKFQN GGSSGSSISN  1080
ATAGILWTGN GVDVREGLFR PCSHKASVES DEQLKRPGDV KLFGQILSHQ SSLQSSGSSS  1140
NGSKSKPPSP KIDRSAARLL NSSRDRLVYS SRPAITAHLG LEERAVRSYT HLDGSTVQPE  1200
PVLMVAKCQR SLAGVPFYSA KNGTLGVFTE YQQPLMRQFP SNPNLQKRNG MELISGFQQP  1260
GKGSRLGGTG ILVSGVTDPV AALKAQYGPG SNILSNDVDP WKDIGSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-14397488494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-14397488494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLA0A0Q3KAE00.0A0A0Q3KAE0_BRADI; Uncharacterized protein
STRINGBRADI2G38160.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.16e-84MYB family protein